PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG034172t3
Common NameTCM_034172
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family bZIP
Protein Properties Length: 462aa    MW: 50026.5 Da    PI: 6.9848
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG034172t3genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1353.2e-11396443552
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                       kr++r   NR +A rs +RK  +i+eLe kv++L++e ++L  +l +l
  Thecc1EG034172t3 396 KRAKRILANRQSAARSKERKMRYIAELEHKVQTLQTEATTLSAQLTML 443
                       9*****************************************999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003389.9E-12392456IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.99394444IPR004827Basic-leucine zipper domain
PfamPF001707.3E-10396443IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.5E-11396450No hitNo description
Gene3DG3DSA:1.20.5.1707.1E-12396445No hitNo description
CDDcd147031.78E-23397444No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 462 aa     Download sequence    Send to blast
MEGISESRSN MQKLQSPPSN SIPKPQSNLD IPIFNASQMA PSPHTRLSPE NNNNKRPGIP  60
PSHPNYPAAT SPYSQIIGSR SNSQQGAPSH SRSLSQPTFF SLDSLPPWSP PPYREPSVAS  120
LSDPASNDVS MEERVVNSNV RSSLPSPVAR GVNEFRVGES SSLPPRKGHR RSSSDVPLGF  180
SAMIQSSPQL LPIGSRGVLD RSVSGRESSS GVEKPIQLVK RESEWSKDGS SNVEGMSERK  240
SEGDVADDLF NAYMNLDSLE TLNSSGTEDK DLDSRASGTK TYGGESSDNE VESRVNGHPI  300
SMQGMSAGAS NEKGVKRSAG GDIAPTARHH RSVSMDSYMG SLQFDDESSK IPPGSSVDAN  360
SGKFNLELGS SEFSEAEMKK IMENEKLAEI ASVDPKRAKR ILANRQSAAR SKERKMRYIA  420
ELEHKVQTLQ TEATTLSAQL TMLQVGINFL YLYPIIRLFS L*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF0480440.0KF048044.1 Firmiana danxiaensis microsatellite Fir_SSR16 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007017725.10.0Basic-leucine zipper transcription factor family protein, putative isoform 3
TrEMBLA0A061FC820.0A0A061FC82_THECC; Basic-leucine zipper transcription factor family protein, putative isoform 3
STRINGVIT_03s0038g00860.t011e-166(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.36e-94bZIP family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]